PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G082300.3
Common NameB456_006G082300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 497aa    MW: 55707.4 Da    PI: 6.3397
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G082300.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.64.3e-11108149446
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         W ++++ ll+++++++G g+W+ +a+++g +++ + c++++ +
  Gorai.006G082300.3 108 WNADDEILLLEGIEMYGLGNWAEVAEHVG-TKSKEKCIDHYTN 149
                         *****************************.***********88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250241.2E-13635494IPR016827Transcriptional adaptor 2
SMARTSM002911.6E-114489IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.9814491IPR000433Zinc finger, ZZ-type
PfamPF005695.9E-104788IPR000433Zinc finger, ZZ-type
SuperFamilySSF578503.53E-1348110No hitNo description
CDDcd023354.32E-254896No hitNo description
PROSITE patternPS0135705077IPR000433Zinc finger, ZZ-type
SuperFamilySSF466893.9E-12101154IPR009057Homeodomain-like
PROSITE profilePS5129320.569103155IPR017884SANT domain
SMARTSM007175.4E-11104153IPR001005SANT/Myb domain
PfamPF002496.9E-11107149IPR001005SANT/Myb domain
CDDcd001675.98E-11108150No hitNo description
Gene3DG3DSA:1.10.10.607.4E-7108150IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0016573Biological Processhistone acetylation
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MGRSRGNFHS ADEDPTQRSR RKKNASAGEN LESSSSGQGT SEGKRALYHC NYCNKDITGK  60
IRIKCAICPD FDLCIECFSV GAEVSPHKSC HLYRVMDNLS FPLICPDWNA DDEILLLEGI  120
EMYGLGNWAE VAEHVGTKSK EKCIDHYTNV YMKSPFFPLP DMSHVVGKNR KELLAMAKGH  180
TEDKKGTMLG ELSVKEESPF SPSRVKVEGS NCGRIMSGLN ADVESGARSS SNSTASATVV  240
KVSNMNQVKD GNVKMEDHQI DRNYGGKKPN SSGNEGPSLV ELSGYNAKRQ EFDPEYDNDA  300
EQLLAEMEFK DTDTEEEREL KLRVLRIYSK RLDERKRRKD FILERNLLYP NPIEKDLSPE  360
ERALCRRYDV FMRFHSKEEH DELLQTVIAE HRTLKRIEEL KEARAAGCRT SAEADRYLEQ  420
KRKREAEESS HRAKDGVQGG PGGQAAPNSF MASESVGKDS NARPTAQASS SYAKDLDIMG  480
FAETQLLSET VRMLYP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1334339RKRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012484629.10.0PREDICTED: transcriptional adapter ADA2b
SwissprotQ9ATB40.0TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLA0A0D2RS400.0A0A0D2RS40_G
STRINGVIT_00s0194g00130.t010.0(Vitis vinifera)
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]